
Packaging illustration; final label and format depend on project.PRODUCT ENQUIRY
LL-37
Request current specification, packaging, availability and batch documentation for LL-37.
- CAS
- 597562-32-8
- Molecular formula
- C205H340N60O53
- Sequence
- [LL-37, 37 aa]
- Molecular weight
- 4493.34
- Availability
- Availability on enquiry
- Purity / documentation
- Confirm against the offered batch
Specification and supply notes
This catalog record identifies a material or project format for enquiry. Please provide target grade, quantity, intended application and destination country. Current availability, packaging, purity and documentation will be confirmed for the offered batch or development project.
Information shown is an identification aid, not a batch certificate, current inventory statement, medical-use instruction or firm commercial offer.
![[Ala113]-MBP (104-118) product presentation](https://www.peptidevaultpro.com/wp-content/themes/peptidevaultpro/assets/products/p-1100.webp?v=3)

